EIF2B1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2110042
Artikelname: EIF2B1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2110042
Hersteller Artikelnummer: orb2110042
Alternativnummer: BYT-ORB2110042-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human EIF2B1
Konjugation: Biotin
Alternative Synonym: EIF2B, EIF2BA
EIF2B1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 001405
UniProt: Q14232
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL