DPH1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2110057
Artikelname: DPH1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2110057
Hersteller Artikelnummer: orb2110057
Alternativnummer: BYT-ORB2110057-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DPH1
Konjugation: Biotin
Alternative Synonym: DPH2L, OVCA1, DEDSSH, DPH2L1
DPH1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 001374
UniProt: Q9BZG8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV