Csnk1a1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2110240
Artikelname: Csnk1a1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2110240
Hersteller Artikelnummer: orb2110240
Alternativnummer: BYT-ORB2110240-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Csnk1a1
Konjugation: Biotin
Alternative Synonym: CK1
Csnk1a1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 446067
UniProt: P97633
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIR