SAMD15 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2110297
Artikelname: SAMD15 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2110297
Hersteller Artikelnummer: orb2110297
Alternativnummer: BYT-ORB2110297-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SAM15
Konjugation: Biotin
Alternative Synonym: FAM15A, C14orf174
SAMD15 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 74kDa
NCBI: 001010860
UniProt: Q9P1V8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PEDYDSGPDEDGELEPERPELPGLHKLYENAEPDTMAKADSKLPAEIYQE