DKFZp686E2433 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2110417
Artikelname: DKFZp686E2433 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2110417
Hersteller Artikelnummer: orb2110417
Alternativnummer: BYT-ORB2110417-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DKFZp686E2433
Konjugation: Biotin
Alternative Synonym: DKFZp686E2433
DKFZp686E2433 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 77kDa
NCBI: 293828
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ATGNVSELGVPLASCAVWSCAPPAEAGPGAFSKRGSREGEMARRLLPAHV