SSX8P Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2110447
Artikelname: SSX8P Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2110447
Hersteller Artikelnummer: orb2110447
Alternativnummer: BYT-ORB2110447-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SSX8
Konjugation: Biotin
Alternative Synonym: SSX8
SSX8P Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 777621
UniProt: Q7RTT4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MTFGRLQRIIPKIMPKKPAEEGNDSKGVSEASGPQNDGKQLRRPGKSKYF