ING2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2111656
Artikelname: ING2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2111656
Hersteller Artikelnummer: orb2111656
Alternativnummer: BYT-ORB2111656-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ING2
Konjugation: Biotin
Alternative Synonym: ING1L, p33ING2
ING2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 001555
UniProt: Q9H160
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKYKKED