WNT3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2112359
Artikelname: WNT3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2112359
Hersteller Artikelnummer: orb2112359
Alternativnummer: BYT-ORB2112359-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WNT3
Konjugation: HRP
Alternative Synonym: INT4, TETAMS
WNT3 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 110380
UniProt: P56703
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: SHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNE