TXNDC15 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2112505
Artikelname: TXNDC15 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2112505
Hersteller Artikelnummer: orb2112505
Alternativnummer: BYT-ORB2112505-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TXNDC15
Konjugation: Biotin
Alternative Synonym: BUG, UNQ335, C5orf14
TXNDC15 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 078991
UniProt: Q96J42
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNV