RGD1305007 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2112510
Artikelname: RGD1305007 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2112510
Hersteller Artikelnummer: orb2112510
Alternativnummer: BYT-ORB2112510-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1305007
Konjugation: FITC
Alternative Synonym: RGD1305007
RGD1305007 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 001013998
UniProt: Q5M843
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RFEGCTPRKCGRGVTDIVITREEAEQIRRIAEKGLSLGGSDGGASILDLH