MGC4172 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2112559
Artikelname: MGC4172 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2112559
Hersteller Artikelnummer: orb2112559
Alternativnummer: BYT-ORB2112559-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MGC4172
Konjugation: Biotin
Alternative Synonym: ARPG836, SDR24C1, spDHRS11
MGC4172 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 077284
UniProt: Q6UWP2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIR