ADAM30 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2112823
Artikelname: ADAM30 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2112823
Hersteller Artikelnummer: orb2112823
Alternativnummer: BYT-ORB2112823-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ADAM30
Konjugation: Biotin
Alternative Synonym: svph4
ADAM30 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 068566
UniProt: Q9UKF2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIH