CDH22 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2112844
Artikelname: CDH22 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2112844
Hersteller Artikelnummer: orb2112844
Alternativnummer: BYT-ORB2112844-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CDH22
Konjugation: Biotin
Alternative Synonym: C20orf25, dJ998H6.1
CDH22 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 73kDa
NCBI: 75754
UniProt: Q9UJ99
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD