PCDHB16 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2112919
Artikelname: PCDHB16 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2112919
Hersteller Artikelnummer: orb2112919
Alternativnummer: BYT-ORB2112919-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCDHB16
Konjugation: Biotin
Alternative Synonym: ME1, PCDH3X, PCDHB8a, PCDH-BETA16
PCDHB16 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 82kDa
NCBI: 066008
UniProt: Q9NRJ7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IPENSPLGSLVATVSARDLDGGANGKISYTLFQPSEDISKTLEVNPMTGE