PSMC3IP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2115430
Artikelname: PSMC3IP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2115430
Hersteller Artikelnummer: orb2115430
Alternativnummer: BYT-ORB2115430-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PSMC3IP
Konjugation: Biotin
Alternative Synonym: HOP2, ODG3, GT198, TBPIP, HUMGT198A
PSMC3IP Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 037422
UniProt: Q9P2W1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIE