KRT23 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2115664
Artikelname: KRT23 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2115664
Hersteller Artikelnummer: orb2115664
Alternativnummer: BYT-ORB2115664-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KRT23
Konjugation: Biotin
Alternative Synonym: K23, CK23, HAIK1
KRT23 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 056330
UniProt: Q9C075
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGR