STYK1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2115679
Artikelname: STYK1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2115679
Hersteller Artikelnummer: orb2115679
Alternativnummer: BYT-ORB2115679-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human STYK1
Konjugation: Biotin
Alternative Synonym: NOK, SuRTK106
STYK1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 060893
UniProt: Q6J9G0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKI