Chst11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2115697
| Artikelname: |
Chst11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2115697 |
| Hersteller Artikelnummer: |
orb2115697 |
| Alternativnummer: |
BYT-ORB2115697-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Chst11 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
C4s, C4ST, C4ST-, C4ST1, C4ST-1, 1110020P09Rik |
| Chst11 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
42kDa |
| NCBI: |
067414 |
| UniProt: |
Q9JME2 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: RMVLATCFGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYN |