AGPAT5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2115718
Artikelname: AGPAT5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2115718
Hersteller Artikelnummer: orb2115718
Alternativnummer: BYT-ORB2115718-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AGPAT5
Konjugation: Biotin
Alternative Synonym: LPAATE, 1AGPAT5
AGPAT5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 060831
UniProt: Q9NUQ2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYTGVQILLYGDLPKNKE