NAXD Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2115745
Artikelname: NAXD Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2115745
Hersteller Artikelnummer: orb2115745
Alternativnummer: BYT-ORB2115745-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLJ10769
Konjugation: Biotin
Alternative Synonym: CARKD, LP3298, PEBEL2
NAXD Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 060680
UniProt: Q8IW45
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ILSNGQQVLVCSQEGSSRRCGGQGDLLSGSLGVLVHWALLAGPQKTNGGI