Tmem33 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2115766
Artikelname: Tmem33 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2115766
Hersteller Artikelnummer: orb2115766
Alternativnummer: BYT-ORB2115766-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
Konjugation: Biotin
Alternative Synonym: Tmem33
Tmem33 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 001029370
UniProt: Q9Z142
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LLHAATYTKKVLDAKGSNSLPLLRSVLDKLSTNQQNILKFIACNEIFLMP