HACD3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2115952
Artikelname: HACD3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2115952
Hersteller Artikelnummer: orb2115952
Alternativnummer: BYT-ORB2115952-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PTPLAD1
Konjugation: Biotin
Alternative Synonym: BIND1, B-IND1, HSPC121, PTPLAD1
HACD3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 057479
UniProt: Q9P035
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: WLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFL