A4GNT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2115991
Artikelname: A4GNT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2115991
Hersteller Artikelnummer: orb2115991
Alternativnummer: BYT-ORB2115991-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human A4GNT
Konjugation: Biotin
Alternative Synonym: alpha4GnT
A4GNT Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 057245
UniProt: Q9UNA3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV