ATP2A3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2116657
Artikelname: ATP2A3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2116657
Hersteller Artikelnummer: orb2116657
Alternativnummer: BYT-ORB2116657-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP2A3
Konjugation: Biotin
Alternative Synonym: SERCA3
ATP2A3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 109kDa
NCBI: 005164
UniProt: Q93084
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS