RARRES3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2116726
Artikelname: RARRES3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2116726
Hersteller Artikelnummer: orb2116726
Alternativnummer: BYT-ORB2116726-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RARRES3
Konjugation: Biotin
Alternative Synonym: RIG1, TIG3, HRSL4, HRASLS4, PLAAT-4, RARRES3, PLA1/2-3
RARRES3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 004576
UniProt: Q9UL19
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV