IFIT3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2117368
| Artikelname: |
IFIT3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2117368 |
| Hersteller Artikelnummer: |
orb2117368 |
| Alternativnummer: |
BYT-ORB2117368-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human IFIT3 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
P60, IRG2, IFI60, IFIT4, ISG60, RIG-G, cig41, CIG-49, GARG-49 |
| IFIT3 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
56kDa |
| NCBI: |
001026853 |
| UniProt: |
O14879 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY |