PCLAF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2117371
| Artikelname: |
PCLAF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2117371 |
| Hersteller Artikelnummer: |
orb2117371 |
| Alternativnummer: |
BYT-ORB2117371-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0101 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
L5, PAF, OEATC, PAF15, OEATC1, p15PAF, NS5ATP9, OEATC-1, p15/PAF, KIAA0101, p15(PAF) |
| PCLAF Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
7kDa |
| NCBI: |
001025160 |
| UniProt: |
A6NNU5 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKEHVLCNLI |
