C21orf13 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2117458
Artikelname: C21orf13 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2117458
Hersteller Artikelnummer: orb2117458
Alternativnummer: BYT-ORB2117458-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf13
Konjugation: Biotin
Alternative Synonym: C21orf13
C21orf13 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 76kDa
NCBI: 689718
UniProt: O95447
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY