COL18A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2117503
Artikelname: COL18A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2117503
Hersteller Artikelnummer: orb2117503
Alternativnummer: BYT-ORB2117503-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-COL18A1 antibody is: synthetic peptide directed towards the Middle region of Human COIA1
Konjugation: Biotin
Alternative Synonym: KS, KNO, GLCC, KNO1
COL18A1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 147 kDa
UniProt: P39060
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VQLEARTPLPRGTDNEVAALQPPVVQLHDSNPYPRREHPHPTARPWRADD