CHAF1B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2117569
Artikelname: CHAF1B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2117569
Hersteller Artikelnummer: orb2117569
Alternativnummer: BYT-ORB2117569-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHAF1B
Konjugation: Biotin
Alternative Synonym: CAF1, MPP7, CAF-1, CAF1A, CAF1P60, CAF-IP60, MPHOSPH7
CHAF1B Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 005432
UniProt: Q13112
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD