CFAP410 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2117575
Artikelname: CFAP410 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2117575
Hersteller Artikelnummer: orb2117575
Alternativnummer: BYT-ORB2117575-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C21orf2
Konjugation: Biotin
Alternative Synonym: RDMS, SMDAX, LRRC76, YF5/A2, C21orf2
CFAP410 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 004919
UniProt: O43822
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DPLDSEEEATSGAQDERGLKPPSRGQFPSLSARDASSSHRGRNVLTAILL