CBR3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2117614
Artikelname: CBR3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2117614
Hersteller Artikelnummer: orb2117614
Alternativnummer: BYT-ORB2117614-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CBR3
Konjugation: Biotin
Alternative Synonym: hCBR3, SDR21C2, HEL-S-25
CBR3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 001227
UniProt: O75828
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: CNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDL