ATP6AP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2118406
| Artikelname: |
ATP6AP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2118406 |
| Hersteller Artikelnummer: |
orb2118406 |
| Alternativnummer: |
BYT-ORB2118406-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human ATP6AP1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
16A, CF2, Ac45, XAP3, XAP-3, ATP6S1, VATPS1, ATP6IP1 |
| ATP6AP1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
52 |
| NCBI: |
001174 |
| UniProt: |
Q15904 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS |
