TMTC4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2118460
Artikelname: TMTC4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2118460
Hersteller Artikelnummer: orb2118460
Alternativnummer: BYT-ORB2118460-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TMTC4
Konjugation: Biotin
Alternative Synonym: FLJ14624, FLJ22153
TMTC4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 001073137
UniProt: Q5T4D3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRW