CRELD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2118487
Artikelname: CRELD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2118487
Hersteller Artikelnummer: orb2118487
Alternativnummer: BYT-ORB2118487-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CRELD1
Konjugation: Biotin
Alternative Synonym: AVSD2, CIRRIN
CRELD1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 001070883
UniProt: Q96HD1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE