Creld1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2118490
Artikelname: Creld1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2118490
Hersteller Artikelnummer: orb2118490
Alternativnummer: BYT-ORB2118490-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Creld1
Konjugation: Biotin
Alternative Synonym: i11E7, AI843811
Creld1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 598691
UniProt: Q91XD7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ACGQCGLGYFEAERNSSHLVCSACFGPCARCTGPEESHCLQCKKGWALHH