Fkrp Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2118598
Artikelname: Fkrp Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2118598
Hersteller Artikelnummer: orb2118598
Alternativnummer: BYT-ORB2118598-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: Biotin
Alternative Synonym: LGMD, MDC1C, LGMD1I, AI842067, AI847300, A830029B19Rik
Fkrp Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 775606
UniProt: Q8CG64
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FPEHFLQPLVPLPFAGFMAQAPNNYRRFLELKFGPGVIENPEYPNPALLS