Hepacam2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2118643
Artikelname: Hepacam2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2118643
Hersteller Artikelnummer: orb2118643
Alternativnummer: BYT-ORB2118643-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hepacam2
Konjugation: Biotin
Alternative Synonym: RGD1305697
Hepacam2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 001100050
UniProt: B5DEN8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VTVPSHTVHGIRGQALYLPVHYGFHTPASDIQIIWLFERSHTTPKYLLGS