RETREG1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2118709
Artikelname: RETREG1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2118709
Hersteller Artikelnummer: orb2118709
Alternativnummer: BYT-ORB2118709-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM134B
Konjugation: Biotin
Alternative Synonym: JK1, JK-1, FAM134B
RETREG1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 001030022
UniProt: Q9H6L5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSV