GALNTL6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2118712
Artikelname: GALNTL6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2118712
Hersteller Artikelnummer: orb2118712
Alternativnummer: BYT-ORB2118712-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GALNTL6
Konjugation: Biotin
Alternative Synonym: GALNT17, GALNACT20, GalNAc-T6L
GALNTL6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 001030017
UniProt: Q49A17
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSI