NEPRO Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2118787
Artikelname: NEPRO Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2118787
Hersteller Artikelnummer: orb2118787
Alternativnummer: BYT-ORB2118787-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C3orf17
Konjugation: Biotin
Alternative Synonym: ANXD3, NET17, C3orf17
NEPRO Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 056227
UniProt: Q6NW34
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KQLLNSGVSMPVIQTKEKMIHENLRGIHENETDSWTVMQINKNSTSGTIK