SC5DL Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2118793
Artikelname: SC5DL Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2118793
Hersteller Artikelnummer: orb2118793
Alternativnummer: BYT-ORB2118793-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SC5DL
Konjugation: Biotin
Alternative Synonym: ERG3, S5DES, SC5DL
SC5DL Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 001020127
UniProt: O75845
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV