LRRC66 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2118817
Artikelname: LRRC66 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2118817
Hersteller Artikelnummer: orb2118817
Alternativnummer: BYT-ORB2118817-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC339977
Konjugation: Biotin
Alternative Synonym: LRRC66
LRRC66 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 98kDa
NCBI: 001019782
UniProt: Q68CR7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ELDPSLSGEITASLCKMLTHAEAQRTGDSKERGGTEQSLWDSQMEFSKER