VMA21 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2118829
Artikelname: VMA21 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2118829
Hersteller Artikelnummer: orb2118829
Alternativnummer: BYT-ORB2118829-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC203547
Konjugation: Biotin
Alternative Synonym: MEAX, XMEA
VMA21 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 11kDa
NCBI: 001017980
UniProt: Q3ZAQ7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS