NIPA2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119027
Artikelname: NIPA2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119027
Hersteller Artikelnummer: orb2119027
Alternativnummer: BYT-ORB2119027-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NIPA2
Konjugation: Biotin
Alternative Synonym: SLC57A2
NIPA2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 001008860
UniProt: Q8N8Q9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV