ATP8B2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119084
Artikelname: ATP8B2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119084
Hersteller Artikelnummer: orb2119084
Alternativnummer: BYT-ORB2119084-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATP8B2
Konjugation: Biotin
Alternative Synonym: ATPID
ATP8B2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 44
NCBI: 001005855
UniProt: P98198
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KTSKYNILTFLPVNLFEQFQEVANTYFLFLLILQLIPQISSLSWFTTIVP