TMEM195 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119168
Artikelname: TMEM195 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119168
Hersteller Artikelnummer: orb2119168
Alternativnummer: BYT-ORB2119168-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM195
Konjugation: Biotin
Alternative Synonym: TMEM195
TMEM195 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 001004320
UniProt: Q6ZNB7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLP