UCRC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2119204
| Artikelname: |
UCRC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2119204 |
| Hersteller Artikelnummer: |
orb2119204 |
| Alternativnummer: |
BYT-ORB2119204-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human UCRC |
| Konjugation: |
Biotin |
| Alternative Synonym: |
QCR9, UCRC, HSPC051, HSPC119, HSPC151, UCCR7.2 |
| UCRC Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
7kDa |
| NCBI: |
037519 |
| UniProt: |
Q9UDW1 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
