TTMB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119207
Artikelname: TTMB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119207
Hersteller Artikelnummer: orb2119207
Alternativnummer: BYT-ORB2119207-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TTMB
Konjugation: Biotin
Alternative Synonym: TTMB
TTMB Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 001003682
UniProt: Q69YZ2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVI