LYCAT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119252
Artikelname: LYCAT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119252
Hersteller Artikelnummer: orb2119252
Alternativnummer: BYT-ORB2119252-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LYCAT
Konjugation: Biotin
Alternative Synonym: LYCAT, AGPAT8, ALCAT1, 1AGPAT8, UNQ1849, HSRG1849
LYCAT Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 001002257
UniProt: Q6UWP7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE